Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
Protein automated matches [190397] (2 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries) |
Domain d1zg9b_: 1zg9 B: [125021] automated match to d1z5ra1 complexed with l06, zn |
PDB Entry: 1zg9 (more details), 2 Å
SCOPe Domain Sequences for d1zg9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zg9b_ c.56.5.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny vlghl
Timeline for d1zg9b_: