| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
| Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
| Protein automated matches [190397] (2 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries) |
| Domain d1zg9a_: 1zg9 A: [125020] automated match to d1z5ra1 complexed with l06, zn |
PDB Entry: 1zg9 (more details), 2 Å
SCOPe Domain Sequences for d1zg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zg9a_ c.56.5.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
vlghl
Timeline for d1zg9a_: