SCOPe 2.01: Domain d1zcab2: 1zca B:54-82,B:205-370

Lineage for d1zcab2 (1zca B:54-82,B:205-370)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries)
   Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372

8. Domain d1zcab2: 1zca B:54-82,B:205-370 [124900]
   Other proteins in same PDB: d1zcaa1, d1zcab1
   automatically matched to 1ZCA A:54-82,A:205-371
   complexed with alf, gdp, mg

Details for d1zcab2

PDB Entry: 1zca, 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-

PDB Compounds: (B:) G alpha i/12

SCOPe Domain Sequences for d1zcab2:

Sequence; same for both SEQRES and ATOM records:

>d1zcab2 c.37.1.8 (B:54-82,B:205-370) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq
kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln
kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt
enirfvfhavkdtilq

Timeline for d1zcab2:

• d1zcab2 first appeared in SCOP 1.73
  
• d1zcab2 appears in SCOP 1.75
  
• d1zcab2 appears in SCOPe 2.02
  
• d1zcab2 appears in the current release, SCOPe 2.08