Lineage for d1zcab2 (1zca B:54-82,B:205-370)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988473Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 988500Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 988504Domain d1zcab2: 1zca B:54-82,B:205-370 [124900]
    Other proteins in same PDB: d1zcaa1, d1zcab1
    automatically matched to 1ZCA A:54-82,A:205-371
    complexed with alf, gdp, mg

Details for d1zcab2

PDB Entry: 1zca (more details), 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-
PDB Compounds: (B:) G alpha i/12

SCOPe Domain Sequences for d1zcab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcab2 c.37.1.8 (B:54-82,B:205-370) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq
kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln
kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt
enirfvfhavkdtilq

SCOPe Domain Coordinates for d1zcab2:

Click to download the PDB-style file with coordinates for d1zcab2.
(The format of our PDB-style files is described here.)

Timeline for d1zcab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zcab1