Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (3 species) common fold is interrupted with an all-alpha domain |
Species Mouse (Mus musculus) [TaxId:10090] [142225] (3 PDB entries) |
Domain d1zcab2: 1zca B:54-82,B:205-370 [124900] Other proteins in same PDB: d1zcaa1, d1zcab1 automatically matched to 1ZCA A:54-82,A:205-371 complexed with alf, gdp, mg |
PDB Entry: 1zca (more details), 2.9 Å
SCOP Domain Sequences for d1zcab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcab2 c.37.1.8 (B:54-82,B:205-370) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt enirfvfhavkdtilq
Timeline for d1zcab2: