PDB entry 1zca

View 1zca on RCSB PDB site
Description: Crystal structure of G alpha 12 in complex with GDP, Mg2+ and AlF4-
Class: signaling protein
Keywords: GTP-binding, Lipoprotein, Membrane, Palmitate, Transducer
Deposited on 2005-04-11, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G alpha i/12
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zcaa1, d1zcaa2
  • Chain 'B':
    Compound: G alpha i/12
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zcab1, d1zcab2
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcaA (A:)
    mgctlsaedkaaverskmidrnlredgerravrrlvkilllgagesgkstflkqmriihg
    refdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpv
    epatfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdil
    larkatkgivehdfvikkipfkmvdvggqrsqrqkwfqcfdgitsilfmvssseydqvlm
    edrrtnrlvesmnifetivnnklffnvsiilflnkmdllvekvksvsikkhfpdfkgdph
    rledvqrylvqcfdrkrrnrskplfhhfttaidtenirfvfhavkdtilqenlkdimlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcaA (A:)
    rlvkilllgagesgkstflkqmriihgrefdqkallefrdtifdnilkgsrvlvdardkl
    gipwqhsenekhgmflmafenkaglpvepatfqlyvpalsalwrdsgireafsrrsefql
    gesvkyfldnldrigqlnyfpskqdillarkatkgivehdfvikkipfkmvdvggqrsqr
    qkwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfl
    nkmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaid
    tenirfvfhavkdtilqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zcaB (B:)
    mgctlsaedkaaverskmidrnlredgerravrrlvkilllgagesgkstflkqmriihg
    refdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpv
    epatfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdil
    larkatkgivehdfvikkipfkmvdvggqrsqrqkwfqcfdgitsilfmvssseydqvlm
    edrrtnrlvesmnifetivnnklffnvsiilflnkmdllvekvksvsikkhfpdfkgdph
    rledvqrylvqcfdrkrrnrskplfhhfttaidtenirfvfhavkdtilqenlkdimlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcaB (B:)
    rlvkilllgagesgkstflkqmriihgrefdqkallefrdtifdnilkgsrvlvdardkl
    gipwqhsenekhgmflmafenkaglpvepatfqlyvpalsalwrdsgireafsrrsefql
    gesvkyfldnldrigqlnyfpskqdillarkatkgivehdfvikkipfkmvdvggqrsqr
    qkwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfl
    nkmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaid
    tenirfvfhavkdtilq