![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
![]() | Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries) |
![]() | Domain d1zc8y1: 1zc8 Y:213-312 [124893] Other proteins in same PDB: d1zc8k1, d1zc8y2, d1zc8y3 automatically matched to d1aipa1 protein/RNA complex |
PDB Entry: 1zc8 (more details), 13 Å
SCOPe Domain Sequences for d1zc8y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc8y1 b.43.3.1 (Y:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1zc8y1: