SCOPe 2.08: Domain d1zc8y3: 1zc8 Y:9-212

Lineage for d1zc8y3 (1zc8 Y:9-212)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52629] (4 PDB entries)

8. Domain d1zc8y3: 1zc8 Y:9-212 [124895]
   Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y2
   automatically matched to d1aipa3
   protein/RNA complex

Details for d1zc8y3

PDB Entry: 1zc8, 13 Å

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex

PDB Compounds: (Y:) elongation factor tu

SCOPe Domain Sequences for d1zc8y3:

Sequence; same for both SEQRES and ATOM records:

>d1zc8y3 c.37.1.8 (Y:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
krgenewvdkiwelldaideyipt

Timeline for d1zc8y3:

• d1zc8y3 first appeared in SCOP 1.73
  
• d1zc8y3 appears in SCOPe 2.07