| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Thermus thermophilus [TaxId:274] [52629] (4 PDB entries) |
| Domain d1zc8y3: 1zc8 Y:9-212 [124895] Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y2 automatically matched to d1aipa3 protein/RNA complex |
PDB Entry: 1zc8 (more details), 13 Å
SCOPe Domain Sequences for d1zc8y3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc8y3 c.37.1.8 (Y:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
krgenewvdkiwelldaideyipt
Timeline for d1zc8y3: