Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (2 species) |
Species Escherichia coli [TaxId:562] [54896] (46 PDB entries) Uniprot P00478 |
Domain d1za1b1: 1za1 B:2-100 [124777] Other proteins in same PDB: d1za1a1, d1za1a2, d1za1b2, d1za1c1, d1za1c2, d1za1d2 automatically matched to d1d09b1 complexed with ctp, zn |
PDB Entry: 1za1 (more details), 2.2 Å
SCOPe Domain Sequences for d1za1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za1b1 d.58.2.1 (B:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki entflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1za1b1: