SCOP 1.75: Domain d1za1b1: 1za1 B:2-100

Lineage for d1za1b1 (1za1 B:2-100)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (2 species)

7. Species Escherichia coli [TaxId:562] [54896] (46 PDB entries)
   Uniprot P00478

8. Domain d1za1b1: 1za1 B:2-100 [124777]
   Other proteins in same PDB: d1za1a1, d1za1a2, d1za1b2, d1za1c1, d1za1c2, d1za1d2
   automatically matched to d1d09b1
   complexed with ctp, zn

Details for d1za1b1

PDB Entry: 1za1, 2.2 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of ctp at 2.20 a resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1za1b1:

Sequence; same for both SEQRES and ATOM records:

>d1za1b1 d.58.2.1 (B:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d1za1b1:

• d1za1b1 first appeared in SCOP 1.73
  
• d1za1b1 appears in SCOPe 2.01
  
• d1za1b1 appears in the current release, SCOPe 2.08