![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) ![]() |
![]() | Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [57828] (46 PDB entries) Uniprot P00478 |
![]() | Domain d1za1b2: 1za1 B:101-153 [124778] Other proteins in same PDB: d1za1a1, d1za1a2, d1za1b1, d1za1c1, d1za1c2, d1za1d1 automatically matched to d1acmb2 complexed with ctp, zn |
PDB Entry: 1za1 (more details), 2.2 Å
SCOPe Domain Sequences for d1za1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d1za1b2: