SCOPe 2.06: Domain d1z9ub_: 1z9u B:

Lineage for d1z9ub_ (1z9u B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)

8. Domain d1z9ub_: 1z9u B: [124771]
   automated match to d1nsla_
   complexed with so4

Details for d1z9ub_

PDB Entry: 1z9u, 2.2 Å

PDB Description: Structural Genomics, The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium

PDB Compounds: (B:) acetyl transferase

SCOPe Domain Sequences for d1z9ub_:

Sequence; same for both SEQRES and ATOM records:

>d1z9ub_ d.108.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
veiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnill
hqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthy
arrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid

Timeline for d1z9ub_:

• d1z9ub_ first appeared in SCOP 1.73, called d1z9ub1
  
• d1z9ub_ appears in SCOPe 2.05
  
• d1z9ub_ appears in SCOPe 2.07
  
• d1z9ub_ appears in the current release, SCOPe 2.08