![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries) |
![]() | Domain d1z9ub_: 1z9u B: [124771] automated match to d1nsla_ complexed with so4 |
PDB Entry: 1z9u (more details), 2.2 Å
SCOPe Domain Sequences for d1z9ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9ub_ d.108.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]} veiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnill hqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthy arrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
Timeline for d1z9ub_: