Lineage for d1z73a1 (1z73 A:315-656)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091611Protein Polymyxin resistance protein ArnA (PrmI) [117419] (1 species)
    evolved new activities: UDP-glucuronic acid decarboxylase, UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  7. 2091612Species Escherichia coli [TaxId:562] [117420] (8 PDB entries)
    Uniprot P77398
  8. 2091617Domain d1z73a1: 1z73 A:315-656 [124585]
    complexed with gol, so4; mutant

Details for d1z73a1

PDB Entry: 1z73 (more details), 2.5 Å

PDB Description: Crystal Structure of E. coli ArnA dehydrogenase (decarboxylase) domain, S433A mutant
PDB Compounds: (A:) protein ArnA

SCOPe Domain Sequences for d1z73a1:

Sequence, based on SEQRES records: (download)

>d1z73a1 c.2.1.2 (A:315-656) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstae
vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyq
dvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt

Sequence, based on observed residues (ATOM records): (download)

>d1z73a1 c.2.1.2 (A:315-656) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstae
vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesvehrkpsir
nahrcldwepkidmqetidetldfflrtvdlt

SCOPe Domain Coordinates for d1z73a1:

Click to download the PDB-style file with coordinates for d1z73a1.
(The format of our PDB-style files is described here.)

Timeline for d1z73a1: