| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin |
| Protein Class B acid phosphatase, AphA [102308] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries) Uniprot P58683 30-237 |
| Domain d1z5ud_: 1z5u D: [124496] automated match to d1rm7a_ complexed with cmp, mg |
PDB Entry: 1z5u (more details), 2.3 Å
SCOPe Domain Sequences for d1z5ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5ud_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
irilraanstykplpqagafgeevivnsey
Timeline for d1z5ud_: