SCOP 1.75: Domain d1z5ud1: 1z5u D:7-214

Lineage for d1z5ud1 (1z5u D:7-214)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [142153] (3 PDB entries)
   Uniprot P58683 30-237

8. Domain d1z5ud1: 1z5u D:7-214 [124496]
   automatically matched to 1Z5G A:7-214
   complexed with cmp, mg

Details for d1z5ud1

PDB Entry: 1z5u, 2.3 Å

PDB Description: crystal structure of s. typhimurium apha complexed with cyclic-amp

PDB Compounds: (D:) AphA protein

SCOP Domain Sequences for d1z5ud1:

Sequence; same for both SEQRES and ATOM records:

>d1z5ud1 c.108.1.12 (D:7-214) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
ilraanstykplpqagafgeevivnsey

Timeline for d1z5ud1:

• d1z5ud1 first appeared in SCOP 1.73
  
• d1z5ud1 is called d1z5ud_ in SCOPe 2.01
  
• d1z5ud1 appears in the current release, SCOPe 2.08, called d1z5ud_