SCOP 1.73: Domain d1z4eb1: 1z4e B:4-153

Lineage for d1z4eb1 (1z4e B:4-153)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Transcriptional regulator BH1968 [143658] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [143659] (1 PDB entry)

8. Domain d1z4eb1: 1z4e B:4-153 [124432]
   automatically matched to 1Z4E A:4-153

Details for d1z4eb1

PDB Entry: 1z4e, 2 Å

PDB Description: crystal structure of transcriptional regulator from bacillus halodurans c-125

PDB Compounds: (B:) Transcriptional regulator

SCOP Domain Sequences for d1z4eb1:

Sequence; same for both SEQRES and ATOM records:

>d1z4eb1 d.108.1.1 (B:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}
hvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacng
eeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliq
lttdkqrpdalrfyeqlgfkasheglkmhf

Timeline for d1z4eb1:

• d1z4eb1 is new in SCOP 1.73
  
• d1z4eb1 appears in SCOP 1.75
  
• d1z4eb1 appears in the current release, SCOPe 2.08, called d1z4eb_