![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
![]() | Protein Transcriptional regulator BH1968 [143658] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [143659] (1 PDB entry) |
![]() | Domain d1z4ea1: 1z4e A:4-153 [124431] |
PDB Entry: 1z4e (more details), 2 Å
SCOP Domain Sequences for d1z4ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} hvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacng eeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliq lttdkqrpdalrfyeqlgfkasheglkmhf
Timeline for d1z4ea1: