Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.2: An insect antifreeze protein [51177] (1 family) superhelical turns are made of three short strands |
Family b.81.2.1: An insect antifreeze protein [51178] (2 proteins) this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain |
Protein automated matches [254467] (1 species) not a true protein |
Species Choristoneura fumiferana [TaxId:7141] [254998] (1 PDB entry) |
Domain d1z2fa_: 1z2f A: [124382] automated match to d1m8na_ |
PDB Entry: 1z2f (more details)
SCOPe Domain Sequences for d1z2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2fa_ b.81.2.1 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]} dgtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidk sqvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsa m
Timeline for d1z2fa_: