SCOPe 2.08: Domain d1z2fa_: 1z2f A:

Lineage for d1z2fa_ (1z2f A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.2: An insect antifreeze protein [51177] (1 family)
   superhelical turns are made of three short strands

5. Family b.81.2.1: An insect antifreeze protein [51178] (2 proteins)
   this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain

6. Protein automated matches [254467] (1 species)
   not a true protein

7. Species Choristoneura fumiferana [TaxId:7141] [254998] (1 PDB entry)

8. Domain d1z2fa_: 1z2f A: [124382]
   automated match to d1m8na_

Details for d1z2fa_

PDB Entry: 1z2f

PDB Description: solution structure of cfafp-501

PDB Compounds: (A:) Antifreeze protein isoform 501

SCOPe Domain Sequences for d1z2fa_:

Sequence; same for both SEQRES and ATOM records:

>d1z2fa_ b.81.2.1 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
dgtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidk
sqvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsa
m

Timeline for d1z2fa_:

• d1z2fa_ first appeared in SCOP 1.73, called d1z2fa1
  
• d1z2fa_ appears in SCOPe 2.07