Lineage for d1z2fa1 (1z2f A:2-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677067Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 677245Superfamily b.81.2: An insect antifreeze protein [51177] (1 family) (S)
    superhelical turns are made of three short strands
  5. 677246Family b.81.2.1: An insect antifreeze protein [51178] (1 protein)
    this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain
  6. 677247Protein Thermal hysteresis protein [51179] (2 species)
    there are different numbers of superhelical turns (and sequence repeats) in different isoforms
  7. 677255Species Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId:7141] [88690] (2 PDB entries)
  8. 677260Domain d1z2fa1: 1z2f A:2-121 [124382]
    automatically matched to d1m8na_

Details for d1z2fa1

PDB Entry: 1z2f (more details)

PDB Description: solution structure of cfafp-501
PDB Compounds: (A:) Antifreeze protein isoform 501

SCOP Domain Sequences for d1z2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2fa1 b.81.2.1 (A:2-121) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId: 7141]}
gtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidks
qvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsam

SCOP Domain Coordinates for d1z2fa1:

Click to download the PDB-style file with coordinates for d1z2fa1.
(The format of our PDB-style files is described here.)

Timeline for d1z2fa1: