Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab4a [142247] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142248] (3 PDB entries) Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184 |
Domain d1z0kc_: 1z0k C: [124323] Other proteins in same PDB: d1z0kb1, d1z0kd_ automated match to d1yu9a1 complexed with gtp, mes, mg |
PDB Entry: 1z0k (more details), 1.92 Å
SCOPe Domain Sequences for d1z0kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0kc_ c.37.1.8 (C:) Rab4a {Human (Homo sapiens) [TaxId: 9606]} ydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwdt aglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkd ldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk
Timeline for d1z0kc_: