Lineage for d1z0kc_ (1z0k C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867445Protein Rab4a [142247] (1 species)
  7. 2867446Species Human (Homo sapiens) [TaxId:9606] [142248] (3 PDB entries)
    Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184
  8. 2867449Domain d1z0kc_: 1z0k C: [124323]
    Other proteins in same PDB: d1z0kb1, d1z0kd_
    automated match to d1yu9a1
    complexed with gtp, mes, mg

Details for d1z0kc_

PDB Entry: 1z0k (more details), 1.92 Å

PDB Description: structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
PDB Compounds: (C:) GTP-binding protein

SCOPe Domain Sequences for d1z0kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0kc_ c.37.1.8 (C:) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
ydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwdt
aglerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkd
ldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk

SCOPe Domain Coordinates for d1z0kc_:

Click to download the PDB-style file with coordinates for d1z0kc_.
(The format of our PDB-style files is described here.)

Timeline for d1z0kc_: