Lineage for d1z0kb1 (1z0k B:441-501)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980331Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) (S)
  5. 1980332Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 protein domains)
  6. 1980333Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)
  7. 1980334Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
    Uniprot Q9H1K0 441-501! Uniprot Q9H1K0 456-501! Uniprot Q9H1K0 734-784
  8. 1980337Domain d1z0kb1: 1z0k B:441-501 [124322]
    Other proteins in same PDB: d1z0ka1, d1z0kc_, d1z0kd_
    1st Rab-binding domain
    complexed with gtp, mes, mg

Details for d1z0kb1

PDB Entry: 1z0k (more details), 1.92 Å

PDB Description: Structure of GTP-Bound Rab4Q67L GTPase in complex with the central Rab binding domain of Rabenosyn-5
PDB Compounds: (B:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOPe Domain Sequences for d1z0kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0kb1 a.2.19.1 (B:441-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
t

SCOPe Domain Coordinates for d1z0kb1:

Click to download the PDB-style file with coordinates for d1z0kb1.
(The format of our PDB-style files is described here.)

Timeline for d1z0kb1: