SCOPe 2.08: Domain d1yyll1: 1yyl L:1-107

Lineage for d1yyll1 (1yyl L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d1yyll1: 1yyl L:1-107 [124225]
   Other proteins in same PDB: d1yylg_, d1yylh1, d1yylh2, d1yyll2, d1yylm1, d1yylp_, d1yylq2, d1yylr1, d1yylr2, d1yyls1
   automatically matched to d1g9ml1
   complexed with nag

Details for d1yyll1

PDB Entry: 1yyl, 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (L:) Antibody 17B Light chain

SCOPe Domain Sequences for d1yyll1:

Sequence; same for both SEQRES and ATOM records:

>d1yyll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

Timeline for d1yyll1:

• d1yyll1 first appeared in SCOP 1.73
  
• d1yyll1 appears in SCOPe 2.07