Lineage for d1yylq2 (1yyl Q:1108-1212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2351429Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2351430Species Human (Homo sapiens) [TaxId:9606] [88569] (148 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2351608Domain d1yylq2: 1yyl Q:1108-1212 [124229]
    Other proteins in same PDB: d1yylg_, d1yylh1, d1yylh2, d1yyll1, d1yylm1, d1yylp_, d1yylq1, d1yylr1, d1yylr2, d1yyls1
    automatically matched to d1g9ml2
    complexed with nag, ndg

Details for d1yylq2

PDB Entry: 1yyl (more details), 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (Q:) Antibody 17B Light chain

SCOPe Domain Sequences for d1yylq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yylq2 b.1.1.2 (Q:1108-1212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1yylq2:

Click to download the PDB-style file with coordinates for d1yylq2.
(The format of our PDB-style files is described here.)

Timeline for d1yylq2: