SCOPe 2.08: Domain d1yylh2: 1yyl H:114-214

Lineage for d1yylh2 (1yyl H:114-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1yylh2: 1yyl H:114-214 [124224]
   Other proteins in same PDB: d1yylg_, d1yylh1, d1yyll1, d1yyll2, d1yylm1, d1yylp_, d1yylq1, d1yylq2, d1yylr1, d1yyls1
   automatically matched to d1ngzb2
   complexed with nag

Details for d1yylh2

PDB Entry: 1yyl, 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (H:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d1yylh2:

Sequence; same for both SEQRES and ATOM records:

>d1yylh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1yylh2:

• d1yylh2 first appeared in SCOP 1.73
  
• d1yylh2 appears in SCOPe 2.07