SCOPe 2.08: Domain d1yxbf2: 1yxb F:4-90

Lineage for d1yxbf2 (1yxb F:4-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry)
   Uniprot Q9EWK0 4-91

8. Domain d1yxbf2: 1yxb F:4-90 [124180]
   Other proteins in same PDB: d1yxba2, d1yxbb3, d1yxbc3, d1yxbd3, d1yxbe3, d1yxbf3, d1yxbg3, d1yxbh3
   automated match to d1yxba1

Details for d1yxbf2

PDB Entry: 1yxb, 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.

PDB Compounds: (F:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1yxbf2:

Sequence, based on SEQRES records:

>d1yxbf2 a.204.1.4 (F:4-90) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae
eisqllyhvqvmmvargislddvyahl

Sequence, based on observed residues (ATOM records):

>d1yxbf2 a.204.1.4 (F:4-90) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
llyhvqvmmvargislddvyahl

Timeline for d1yxbf2:

• d1yxbf2 first appeared in SCOP 1.73, called d1yxbf1
  
• d1yxbf2 appears in SCOPe 2.07