Lineage for d1yxbb2 (1yxb B:4-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014645Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2014646Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2014688Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 2014689Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 2014715Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry)
    Uniprot Q9EWK0 4-91
  8. 2014717Domain d1yxbb2: 1yxb B:4-90 [124176]
    Other proteins in same PDB: d1yxba2, d1yxbb3, d1yxbc3, d1yxbd3, d1yxbe3, d1yxbf3, d1yxbg3, d1yxbh3
    automated match to d1yxba1

Details for d1yxbb2

PDB Entry: 1yxb (more details), 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
PDB Compounds: (B:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1yxbb2:

Sequence, based on SEQRES records: (download)

>d1yxbb2 a.204.1.4 (B:4-90) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae
eisqllyhvqvmmvargislddvyahl

Sequence, based on observed residues (ATOM records): (download)

>d1yxbb2 a.204.1.4 (B:4-90) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
llyhvqvmmvargislddvyahl

SCOPe Domain Coordinates for d1yxbb2:

Click to download the PDB-style file with coordinates for d1yxbb2.
(The format of our PDB-style files is described here.)

Timeline for d1yxbb2: