![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein YsnE [143654] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143655] (1 PDB entry) Uniprot P94562 1-151 |
![]() | Domain d1yx0a1: 1yx0 A:1-151 [124168] |
PDB Entry: 1yx0 (more details)
SCOPe Domain Sequences for d1yx0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagc galkeldtrhgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfepa rklyesfgfqycepfadygedpnsvfmtkkl
Timeline for d1yx0a1: