Lineage for d1yx0a1 (1yx0 A:1-151)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921468Protein Hypothetical protein YsnE [143654] (1 species)
  7. 1921469Species Bacillus subtilis [TaxId:1423] [143655] (1 PDB entry)
    Uniprot P94562 1-151
  8. 1921470Domain d1yx0a1: 1yx0 A:1-151 [124168]

Details for d1yx0a1

PDB Entry: 1yx0 (more details)

PDB Description: Solution Structure of Bacillus subtilis Protein ysnE: The Northeast Structural Genomics Consortium Target SR220
PDB Compounds: (A:) hypothetical protein ysnE

SCOPe Domain Sequences for d1yx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}
mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagc
galkeldtrhgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfepa
rklyesfgfqycepfadygedpnsvfmtkkl

SCOPe Domain Coordinates for d1yx0a1:

Click to download the PDB-style file with coordinates for d1yx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1yx0a1: