SCOPe 2.08: Domain d1yx0a1: 1yx0 A:1-149

Lineage for d1yx0a1 (1yx0 A:1-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein YsnE [143654] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143655] (1 PDB entry)
   Uniprot P94562 1-151

8. Domain d1yx0a1: 1yx0 A:1-149 [124168]
   Other proteins in same PDB: d1yx0a2

Details for d1yx0a1

PDB Entry: 1yx0

PDB Description: solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220

PDB Compounds: (A:) hypothetical protein ysnE

SCOPe Domain Sequences for d1yx0a1:

Sequence; same for both SEQRES and ATOM records:

>d1yx0a1 d.108.1.1 (A:1-149) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}
mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagc
galkeldtrhgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfepa
rklyesfgfqycepfadygedpnsvfmtk

Timeline for d1yx0a1:

• d1yx0a1 first appeared in SCOP 1.73
  
• d1yx0a1 appears in SCOPe 2.07