SCOPe 2.07: Domain d1yvob_: 1yvo B:

Lineage for d1yvob_ (1yvo B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [186891] (1 PDB entry)

8. Domain d1yvob_: 1yvo B: [124107]
   Other proteins in same PDB: d1yvoa1
   automated match to d1vhsa_

Details for d1yvob_

PDB Entry: 1yvo, 1.9 Å

PDB Description: hypothetical acetyltransferase from P.aeruginosa PA01

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1yvob_:

Sequence; same for both SEQRES and ATOM records:

>d1yvob_ d.108.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasda
agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva
aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

Timeline for d1yvob_:

• d1yvob_ first appeared in SCOP 1.73, called d1yvob1
  
• d1yvob_ appears in SCOPe 2.06
  
• d1yvob_ appears in the current release, SCOPe 2.08