Lineage for d1yvob_ (1yvo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969378Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [186891] (1 PDB entry)
  8. 2969379Domain d1yvob_: 1yvo B: [124107]
    Other proteins in same PDB: d1yvoa1
    automated match to d1vhsa_

Details for d1yvob_

PDB Entry: 1yvo (more details), 1.9 Å

PDB Description: hypothetical acetyltransferase from P.aeruginosa PA01
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1yvob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvob_ d.108.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasda
agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva
aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOPe Domain Coordinates for d1yvob_:

Click to download the PDB-style file with coordinates for d1yvob_.
(The format of our PDB-style files is described here.)

Timeline for d1yvob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yvoa1