Lineage for d1yvob1 (1yvo B:4-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731125Protein Hypothetical protein PA4866 [143694] (1 species)
    Putative phosphinothricin acetyltransferase
  7. 731126Species Pseudomonas aeruginosa [TaxId:287] [143695] (2 PDB entries)
  8. 731128Domain d1yvob1: 1yvo B:4-172 [124107]
    automatically matched to 1YVO A:4-172

Details for d1yvob1

PDB Entry: 1yvo (more details), 1.9 Å

PDB Description: hypothetical acetyltransferase from P.aeruginosa PA01
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1yvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvob1 d.108.1.1 (B:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaag
evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai
esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOP Domain Coordinates for d1yvob1:

Click to download the PDB-style file with coordinates for d1yvob1.
(The format of our PDB-style files is described here.)

Timeline for d1yvob1: