![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (28 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [186891] (1 PDB entry) |
![]() | Domain d1yvob_: 1yvo B: [124107] Other proteins in same PDB: d1yvoa1 automated match to d1vhsa_ |
PDB Entry: 1yvo (more details), 1.9 Å
SCOPe Domain Sequences for d1yvob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvob_ d.108.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasda agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
Timeline for d1yvob_: