Lineage for d1yvkd_ (1yvk D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664469Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species)
  7. 1664470Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry)
    Uniprot O32248 5-156
  8. 1664474Domain d1yvkd_: 1yvk D: [124104]
    automated match to d1yvka1
    complexed with coa

Details for d1yvkd_

PDB Entry: 1yvk (more details), 3.01 Å

PDB Description: crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.
PDB Compounds: (D:) hypothetical protein BSU33890

SCOPe Domain Sequences for d1yvkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvkd_ d.108.1.1 (D:) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}
klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
idhdfflrhydedifengiqcrdmvrlyldll

SCOPe Domain Coordinates for d1yvkd_:

Click to download the PDB-style file with coordinates for d1yvkd_.
(The format of our PDB-style files is described here.)

Timeline for d1yvkd_: