![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry) Uniprot O32248 5-156 |
![]() | Domain d1yvkc_: 1yvk C: [124103] automated match to d1yvka1 complexed with coa |
PDB Entry: 1yvk (more details), 3.01 Å
SCOPe Domain Sequences for d1yvkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvkc_ d.108.1.1 (C:) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa idhdfflrhydedifengiqcrdmvrlyldll
Timeline for d1yvkc_: