Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species) |
Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry) Uniprot O32248 5-156 |
Domain d1yvkc2: 1yvk C:5-155 [124103] Other proteins in same PDB: d1yvka2, d1yvkb3, d1yvkc3, d1yvkd3 automated match to d1yvka1 complexed with coa |
PDB Entry: 1yvk (more details), 3.01 Å
SCOPe Domain Sequences for d1yvkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvkc2 d.108.1.1 (C:5-155) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa idhdfflrhydedifengiqcrdmvrlyldl
Timeline for d1yvkc2: