SCOP 1.73: Domain d1yvkd1: 1yvk D:5-156

Lineage for d1yvkd1 (1yvk D:5-156)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry)

8. Domain d1yvkd1: 1yvk D:5-156 [124104]
   automatically matched to 1YVK A:5-156
   complexed with coa

Details for d1yvkd1

PDB Entry: 1yvk, 3.01 Å

PDB Description: crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.

PDB Compounds: (D:) hypothetical protein BSU33890

SCOP Domain Sequences for d1yvkd1:

Sequence; same for both SEQRES and ATOM records:

>d1yvkd1 d.108.1.1 (D:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}
klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
idhdfflrhydedifengiqcrdmvrlyldll

Timeline for d1yvkd1:

• d1yvkd1 is new in SCOP 1.73
  
• d1yvkd1 appears in SCOP 1.75
  
• d1yvkd1 appears in the current release, SCOPe 2.08, called d1yvkd2