SCOPe 2.02: Domain d1yvha1: 1yvh A:178-263

Lineage for d1yvha1 (1yvh A:178-263)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (9 PDB entries)

8. Domain d1yvha1: 1yvh A:178-263 [124096]
   Other proteins in same PDB: d1yvha2, d1yvha3
   automatically matched to d1b47a1
   complexed with mg

Details for d1yvha1

PDB Entry: 1yvh, 2.05 Å

PDB Description: Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide

PDB Compounds: (A:) CBL E3 ubiquitin protein ligase

SCOPe Domain Sequences for d1yvha1:

Sequence; same for both SEQRES and ATOM records:

>d1yvha1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d1yvha1:

• d1yvha1 first appeared in SCOP 1.73
  
• d1yvha1 appears in SCOPe 2.01
  
• d1yvha1 appears in SCOPe 2.03
  
• d1yvha1 appears in the current release, SCOPe 2.08