| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
| Protein Cbl [47561] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries) |
| Domain d1yvha1: 1yvh A:178-263 [124096] Other proteins in same PDB: d1yvha2, d1yvha3 automatically matched to d1b47a1 complexed with mg |
PDB Entry: 1yvh (more details), 2.05 Å
SCOPe Domain Sequences for d1yvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvha1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav
Timeline for d1yvha1: