Lineage for d1yvha1 (1yvh A:178-263)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269608Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 1269612Protein Cbl [47561] (1 species)
  7. 1269613Species Human (Homo sapiens) [TaxId:9606] [47562] (9 PDB entries)
  8. 1269619Domain d1yvha1: 1yvh A:178-263 [124096]
    Other proteins in same PDB: d1yvha2, d1yvha3
    automatically matched to d1b47a1
    complexed with mg

Details for d1yvha1

PDB Entry: 1yvh (more details), 2.05 Å

PDB Description: Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
PDB Compounds: (A:) CBL E3 ubiquitin protein ligase

SCOPe Domain Sequences for d1yvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvha1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d1yvha1:

Click to download the PDB-style file with coordinates for d1yvha1.
(The format of our PDB-style files is described here.)

Timeline for d1yvha1: