Lineage for d1yuda1 (1yud A:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814960Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. 2814970Protein Hypothetical protein SO0799 [141607] (1 species)
  7. 2814971Species Shewanella oneidensis [TaxId:70863] [141608] (1 PDB entry)
    Uniprot Q8EIN8 1-158
  8. 2814972Domain d1yuda1: 1yud A:1-158 [124046]
    Other proteins in same PDB: d1yudb_, d1yudc_, d1yudd_, d1yude_, d1yudf_, d1yudg_, d1yudh_, d1yudi_, d1yudj_

Details for d1yuda1

PDB Entry: 1yud (more details), 2.7 Å

PDB Description: X-ray Crystal Structure of Protein SO0799 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR12.
PDB Compounds: (A:) hypothetical protein SO0799

SCOPe Domain Sequences for d1yuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]}
mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltad
emwyfhagqsltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvg
cmvspgftfddfelfsqeallamypqhkavvqklsrpe

SCOPe Domain Coordinates for d1yuda1:

Click to download the PDB-style file with coordinates for d1yuda1.
(The format of our PDB-style files is described here.)

Timeline for d1yuda1: