Lineage for d1yudd_ (1yud D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814960Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. 2814981Protein automated matches [190840] (1 species)
    not a true protein
  7. 2814982Species Shewanella oneidensis [TaxId:211586] [188155] (1 PDB entry)
  8. 2814985Domain d1yudd_: 1yud D: [124049]
    Other proteins in same PDB: d1yuda1
    automated match to d1yuda1

Details for d1yudd_

PDB Entry: 1yud (more details), 2.7 Å

PDB Description: X-ray Crystal Structure of Protein SO0799 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR12.
PDB Compounds: (D:) hypothetical protein SO0799

SCOPe Domain Sequences for d1yudd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yudd_ b.82.1.16 (D:) automated matches {Shewanella oneidensis [TaxId: 211586]}
mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltad
emwyfhagqsltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvg
cmvspgftfddfelfsqeallamypqhkavvqklsrpe

SCOPe Domain Coordinates for d1yudd_:

Click to download the PDB-style file with coordinates for d1yudd_.
(The format of our PDB-style files is described here.)

Timeline for d1yudd_: