Lineage for d1yt3a3 (1yt3 A:1-193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886842Protein Ribonuclease D, catalytic domain [142495] (1 species)
  7. 2886843Species Escherichia coli [TaxId:562] [142496] (1 PDB entry)
    Uniprot P09155 1-193
  8. 2886844Domain d1yt3a3: 1yt3 A:1-193 [123994]
    Other proteins in same PDB: d1yt3a1, d1yt3a2
    complexed with so4, zn

Details for d1yt3a3

PDB Entry: 1yt3 (more details), 1.6 Å

PDB Description: Crystal Structure of Escherichia coli RNase D, an exoribonuclease involved in structured RNA processing
PDB Compounds: (A:) Ribonuclease D

SCOPe Domain Sequences for d1yt3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}
mnyqmittddalaslceavrafpaialdtefvrtrtyypqlgliqlfdgehlalidplgi
tdwsplkailrdpsitkflhagsedlevflnvfgelpqplidtqilaafcgrpmswgfas
mveeysgvtldksesrtdwlarplterqceyaaadvwyllpitaklmveteasgwlpaal
decrlmqmrrqev

SCOPe Domain Coordinates for d1yt3a3:

Click to download the PDB-style file with coordinates for d1yt3a3.
(The format of our PDB-style files is described here.)

Timeline for d1yt3a3: