PDB entry 1yt3

View 1yt3 on RCSB PDB site
Description: Crystal Structure of Escherichia coli RNase D, an exoribonuclease involved in structured RNA processing
Class: hydrolase,translation
Keywords: RNase; exoribonuclease; ribonuclease; exonuclease; nuclease; hydrolase; tRNA processing, HYDROLASE,TRANSLATION
Deposited on 2005-02-09, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease D
    Species: Escherichia coli [TaxId:562]
    Gene: RND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yt3a1, d1yt3a2, d1yt3a3
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yt3A (A:)
    mnyqmittddalaslceavrafpaialdtefvrtrtyypqlgliqlfdgehlalidplgi
    tdwsplkailrdpsitkflhagsedlevflnvfgelpqplidtqilaafcgrpmswgfas
    mveeysgvtldksesrtdwlarplterqceyaaadvwyllpitaklmveteasgwlpaal
    decrlmqmrrqevvapedawrditnawqlrtrqlaclqlladwrlrkarerdlavnfvvr
    eehlwsvarympgslgeldslglsgseirfhgktllalvekaqtlpedalpqpmlnlmdm
    pgyrkafkaikslitdvsethkisaellasrrqinqllnwhwklkpqnnlpelisgwrge
    lmaealhnllqeypq