Lineage for d1yt3a2 (1yt3 A:295-375)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716277Family a.60.8.3: RNase D C-terminal domains [140643] (1 protein)
    tandem repeat of two domains of this fold, the first domain belongs to Pfam PF00570
  6. 2716278Protein Ribonuclease D [140644] (1 species)
  7. 2716279Species Escherichia coli [TaxId:562] [140645] (1 PDB entry)
    Uniprot P09155 194-294! Uniprot P09155 295-375
  8. 2716281Domain d1yt3a2: 1yt3 A:295-375 [123993]
    Other proteins in same PDB: d1yt3a3
    complexed with so4, zn

Details for d1yt3a2

PDB Entry: 1yt3 (more details), 1.6 Å

PDB Description: Crystal Structure of Escherichia coli RNase D, an exoribonuclease involved in structured RNA processing
PDB Compounds: (A:) Ribonuclease D

SCOPe Domain Sequences for d1yt3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yt3a2 a.60.8.3 (A:295-375) Ribonuclease D {Escherichia coli [TaxId: 562]}
lnlmdmpgyrkafkaikslitdvsethkisaellasrrqinqllnwhwklkpqnnlpeli
sgwrgelmaealhnllqeypq

SCOPe Domain Coordinates for d1yt3a2:

Click to download the PDB-style file with coordinates for d1yt3a2.
(The format of our PDB-style files is described here.)

Timeline for d1yt3a2: