SCOP 1.73: Domain d1yt3a3: 1yt3 A:1-193

Lineage for d1yt3a3 (1yt3 A:1-193)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Ribonuclease D, catalytic domain [142495] (1 species)

7. Species Escherichia coli [TaxId:562] [142496] (1 PDB entry)

8. Domain d1yt3a3: 1yt3 A:1-193 [123994]
   Other proteins in same PDB: d1yt3a1, d1yt3a2
   complexed with so4, zn

Details for d1yt3a3

PDB Entry: 1yt3, 1.6 Å

PDB Description: Crystal Structure of Escherichia coli RNase D, an exoribonuclease involved in structured RNA processing

PDB Compounds: (A:) Ribonuclease D

SCOP Domain Sequences for d1yt3a3:

Sequence; same for both SEQRES and ATOM records:

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}
mnyqmittddalaslceavrafpaialdtefvrtrtyypqlgliqlfdgehlalidplgi
tdwsplkailrdpsitkflhagsedlevflnvfgelpqplidtqilaafcgrpmswgfas
mveeysgvtldksesrtdwlarplterqceyaaadvwyllpitaklmveteasgwlpaal
decrlmqmrrqev

Timeline for d1yt3a3:

• d1yt3a3 is new in SCOP 1.73
  
• d1yt3a3 appears in SCOP 1.75
  
• d1yt3a3 appears in the current release, SCOPe 2.08