| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins) contains Pfam PF00929 |
| Protein Ribonuclease D, catalytic domain [142495] (1 species) |
| Species Escherichia coli [TaxId:562] [142496] (1 PDB entry) Uniprot P09155 1-193 |
| Domain d1yt3a3: 1yt3 A:1-193 [123994] Other proteins in same PDB: d1yt3a1, d1yt3a2 complexed with so4, zn |
PDB Entry: 1yt3 (more details), 1.6 Å
SCOP Domain Sequences for d1yt3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}
mnyqmittddalaslceavrafpaialdtefvrtrtyypqlgliqlfdgehlalidplgi
tdwsplkailrdpsitkflhagsedlevflnvfgelpqplidtqilaafcgrpmswgfas
mveeysgvtldksesrtdwlarplterqceyaaadvwyllpitaklmveteasgwlpaal
decrlmqmrrqev
Timeline for d1yt3a3: