Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein automated matches [190241] (13 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187674] (2 PDB entries) |
Domain d1yred_: 1yre D: [123922] Other proteins in same PDB: d1yrea1 automated match to d1yrea1 complexed with coa |
PDB Entry: 1yre (more details), 2.15 Å
SCOPe Domain Sequences for d1yred_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yred_ d.108.1.1 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka aleasft
Timeline for d1yred_: