Lineage for d1yred1 (1yre D:11-193)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731119Protein Hypothetical protein PA3270 [143686] (1 species)
  7. 731120Species Pseudomonas aeruginosa [TaxId:287] [143687] (1 PDB entry)
  8. 731124Domain d1yred1: 1yre D:11-193 [123922]
    automatically matched to 1YRE A:11-193
    complexed with coa

Details for d1yred1

PDB Entry: 1yre (more details), 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
PDB Compounds: (D:) hypothetical protein PA3270

SCOP Domain Sequences for d1yred1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yred1 d.108.1.1 (D:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}
lpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregralp
lavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmv
rvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaale
asf

SCOP Domain Coordinates for d1yred1:

Click to download the PDB-style file with coordinates for d1yred1.
(The format of our PDB-style files is described here.)

Timeline for d1yred1: